Lineage for d3froa1 (3fro A:1-437)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517892Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2517893Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2518325Family c.87.1.8: Glycosyl transferases group 1 [110734] (4 proteins)
    Pfam PF00534
  6. 2518342Protein automated matches [190508] (1 species)
    not a true protein
  7. 2518343Species Pyrococcus abyssi [TaxId:29292] [187462] (2 PDB entries)
  8. 2518346Domain d3froa1: 3fro A:1-437 [176004]
    Other proteins in same PDB: d3froa2, d3frob2, d3froc2
    automated match to d2bisa1
    complexed with nhf, po4, trs

Details for d3froa1

PDB Entry: 3fro (more details), 2.5 Å

PDB Description: crystal structure of pyrococcus abyssi glycogen synthase with open and closed conformations
PDB Compounds: (A:) glga glycogen synthase

SCOPe Domain Sequences for d3froa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3froa1 c.87.1.8 (A:1-437) automated matches {Pyrococcus abyssi [TaxId: 29292]}
mkvlllgfeflpvkvgglaealtaisealaslghevlvftpshgrfqgeeigkirvfgee
vqvkvsyeergnlriyriggglldsedvygpgwdglirkavtfgrasvlllndllreepl
pdvvhfhdwhtvfagalikkyfkipavftihrlnksklpafyfheaglselapypdidpe
htggyiadivttvsrgylidewgffrnfegkityvfngidcsfwnesyltgsrderkksl
lskfgmdegvtfmfigrfdrgqkgvdvllkaieilsskkefqemrfiiigkgdpelegwa
rsleekhgnvkvitemlsrefvrelygsvdfviipsyfepfglvaleamclgaipiasav
gglrdiitnetgilvkagdpgelanailkalelsrsdlskfrenckkramsfsweksaer
yvkaytgsidrafdfil

SCOPe Domain Coordinates for d3froa1:

Click to download the PDB-style file with coordinates for d3froa1.
(The format of our PDB-style files is described here.)

Timeline for d3froa1: