SCOPe 2.02: Domain d1gsyb1: 1gsy B:79-209

Lineage for d1gsyb1 (1gsy B:79-209)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47621] (9 PDB entries)

8. Domain d1gsyb1: 1gsy B:79-209 [17597]
   Other proteins in same PDB: d1gsya2, d1gsyb2
   complexed with gsh

Details for d1gsyb1

PDB Entry: 1gsy, 2.44 Å

PDB Description: glutathione s-transferase yfyf, class pi, complexed with glutathione

PDB Compounds: (B:) glutathione s-transferase class pi

SCOPe Domain Sequences for d1gsyb1:

Sequence; same for both SEQRES and ATOM records:

>d1gsyb1 a.45.1.1 (B:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

Timeline for d1gsyb1:

• d1gsyb1 first appeared (with stable ids) in SCOP 1.55
  
• d1gsyb1 appears in SCOPe 2.01
  
• d1gsyb1 appears in SCOPe 2.03
  
• d1gsyb1 appears in the current release, SCOPe 2.08