Lineage for d2glra1 (2glr A:79-209)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1089232Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1089233Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1089234Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 1089512Protein Class pi GST [81347] (4 species)
  7. 1089609Species Mouse (Mus musculus) [TaxId:10090] [47621] (9 PDB entries)
  8. 1089616Domain d2glra1: 2glr A:79-209 [17594]
    Other proteins in same PDB: d2glra2, d2glrb2
    complexed with gtx

Details for d2glra1

PDB Entry: 2glr (more details), 2.2 Å

PDB Description: molecular structure at 1.8 angstroms of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors
PDB Compounds: (A:) glutathione s-transferase yfyf

SCOPe Domain Sequences for d2glra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glra1 a.45.1.1 (A:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

SCOPe Domain Coordinates for d2glra1:

Click to download the PDB-style file with coordinates for d2glra1.
(The format of our PDB-style files is described here.)

Timeline for d2glra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2glra2