Lineage for d3fncb_ (3fnc B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921812Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1921813Protein automated matches [190038] (32 species)
    not a true protein
  7. 1921921Species Listeria innocua [TaxId:272626] [188770] (1 PDB entry)
  8. 1921923Domain d3fncb_: 3fnc B: [175910]
    automated match to d1wk4a_
    complexed with edo, mli

Details for d3fncb_

PDB Entry: 3fnc (more details), 1.75 Å

PDB Description: crystal structure of a putative acetyltransferase from listeria innocua
PDB Compounds: (B:) putative acetyltransferase

SCOPe Domain Sequences for d3fncb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fncb_ d.108.1.0 (B:) automated matches {Listeria innocua [TaxId: 272626]}
amdfhirkatnsdaeaiqhvattswhhtyqdlipsdvqddflkrfynvetlhnrisatpf
avleqadkvigfanfielekgkselaafyllpevtqrglgtellevgmtlfhvplpmfvn
vekgnetaihfykakgfvqveeftedfygypletirfnlnh

SCOPe Domain Coordinates for d3fncb_:

Click to download the PDB-style file with coordinates for d3fncb_.
(The format of our PDB-style files is described here.)

Timeline for d3fncb_: