SCOPe 2.01: Domain d3fncb_: 3fnc B:

Lineage for d3fncb_ (3fnc B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (8 species)
   not a true protein

7. Species Listeria innocua [TaxId:272626] [188770] (1 PDB entry)

8. Domain d3fncb_: 3fnc B: [175910]
   automated match to d1wk4a_
   complexed with edo, mli

Details for d3fncb_

PDB Entry: 3fnc, 1.75 Å

PDB Description: crystal structure of a putative acetyltransferase from listeria innocua

PDB Compounds: (B:) putative acetyltransferase

SCOPe Domain Sequences for d3fncb_:

Sequence; same for both SEQRES and ATOM records:

>d3fncb_ d.108.1.0 (B:) automated matches {Listeria innocua [TaxId: 272626]}
amdfhirkatnsdaeaiqhvattswhhtyqdlipsdvqddflkrfynvetlhnrisatpf
avleqadkvigfanfielekgkselaafyllpevtqrglgtellevgmtlfhvplpmfvn
vekgnetaihfykakgfvqveeftedfygypletirfnlnh

Timeline for d3fncb_:

• d3fncb_ is new in SCOPe 2.01-stable
  
• d3fncb_ appears in SCOPe 2.02
  
• d3fncb_ appears in the current release, SCOPe 2.08, called d3fncb1