Lineage for d3fkwb_ (3fkw B:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1232773Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1232774Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1232775Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1232789Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1232808Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (67 PDB entries)
  8. 1232822Domain d3fkwb_: 3fkw B: [175862]
    automated match to d1c3ba_
    complexed with k, po4; mutant

Details for d3fkwb_

PDB Entry: 3fkw (more details), 1.5 Å

PDB Description: ampc k67r mutant apo structure
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d3fkwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fkwb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsrtftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOPe Domain Coordinates for d3fkwb_:

Click to download the PDB-style file with coordinates for d3fkwb_.
(The format of our PDB-style files is described here.)

Timeline for d3fkwb_: