SCOPe 2.02: Domain d2gsra1: 2gsr A:77-207

Lineage for d2gsra1 (2gsr A:77-207)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [47620] (1 PDB entry)

8. Domain d2gsra1: 2gsr A:77-207 [17586]
   Other proteins in same PDB: d2gsra2, d2gsrb2
   complexed with gts

Details for d2gsra1

PDB Entry: 2gsr, 2.11 Å

PDB Description: structure of porcine class pi glutathione s-transferase

PDB Compounds: (A:) class pi gst glutathione s-transferase

SCOPe Domain Sequences for d2gsra1:

Sequence; same for both SEQRES and ATOM records:

>d2gsra1 a.45.1.1 (A:77-207) Class pi GST {Pig (Sus scrofa) [TaxId: 9823]}
ygkdqkeaalvdmvndgvedlrckyatliytnyeagkekyvkelpehlkpfetllsqnqg
gqafvvgsqisfadynlldllrihqvlnpscldafpllsayvarlsarpkikaflaspeh
vnrpingngkq

Timeline for d2gsra1:

• d2gsra1 first appeared (with stable ids) in SCOP 1.55
  
• d2gsra1 appears in SCOPe 2.01
  
• d2gsra1 appears in SCOPe 2.03
  
• d2gsra1 appears in the current release, SCOPe 2.08