Lineage for d3fk0a_ (3fk0 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031026Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1031036Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 1031046Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
  6. 1031133Protein automated matches [190917] (3 species)
    not a true protein
  7. 1031139Species Escherichia coli K-12 [TaxId:83333] [188769] (7 PDB entries)
  8. 1031143Domain d3fk0a_: 3fk0 A: [175847]
    automated match to d1epsa_
    complexed with fmt, s3p; mutant

Details for d3fk0a_

PDB Entry: 3fk0 (more details), 1.7 Å

PDB Description: e. coli epsp synthase (tips mutation) liganded with s3p
PDB Compounds: (A:) 3-phosphoshikimate 1-carboxyvinyltransferase

SCOPe Domain Sequences for d3fk0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fk0a_ d.68.2.2 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mesltlqpiarvdgtinlpgsksvsnralllaalahgktvltnlldsddvrhmlnaltal
gvsytlsadrtrceiignggplhaegalelflgnagiamrslaaalclgsndivltgepr
mkerpighlvdalrlggakityleqenypplrlqggftggnvdvdgsvssqfltallmta
plapedtvirikgdlvskpyiditlnlmktfgveienqhyqqfvvkggqsyqspgtylve
gdassasyflaaaaikggtvkvtgigrnsmqgdirfadvlekmgaticwgddyisctrge
lnaidmdmnhipdaamtiataalfakgtttlrniynwrvketdrlfamatelrkvgaeve
eghdyiritppeklnfaeiatyndhrmamcfslvalsdtpvtildpkctaktfpdyfeql
arisqaa

SCOPe Domain Coordinates for d3fk0a_:

Click to download the PDB-style file with coordinates for d3fk0a_.
(The format of our PDB-style files is described here.)

Timeline for d3fk0a_: