![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
![]() | Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (4 species) overall structure is similar to TyrRS |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [52379] (11 PDB entries) |
![]() | Domain d3fi0m_: 3fi0 M: [175810] automated match to d1d2ra_ protein/RNA complex; complexed with amp, po4, trp |
PDB Entry: 3fi0 (more details), 2.7 Å
SCOPe Domain Sequences for d3fi0m_:
Sequence, based on SEQRES records: (download)
>d3fi0m_ c.26.1.1 (M:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]} mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl degaekanrvasemvrkmeqamglgr
>d3fi0m_ c.26.1.1 (M:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]} mktifsgiqtignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirrlaaly lavgidptqatlfiqsevpahaqaawmlqcivyigelermtqvsaglltypplmaadill yntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvgarimslvdptkkmsk sdpnpkayitllddaktiekkikssegtirygisnllniystlsgqsieelerqyegkgy gvfkadlaqvvietlrpiqeryhhwmeseeldrvldegaekanrvasemvrkmeqamglg r
Timeline for d3fi0m_: