SCOPe 2.03: Domain d3fhvb_: 3fhv B:

Lineage for d3fhvb_ (3fhv B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (8 families)
   bacterial filament proteins

5. Family d.24.1.1: Pilin [54524] (5 proteins)

6. Protein automated matches [190127] (3 species)
   not a true protein

7. Species Salmonella typhi [TaxId:601] [189084] (2 PDB entries)

8. Domain d3fhvb_: 3fhv B: [175793]
   automated match to d1q5fa_

Details for d3fhvb_

PDB Entry: 3fhv, 1.9 Å

PDB Description: structural basis of salmonella typhi type ivb pils and cystic fibrosis transmembrane conductance regulator (cftr) interaction

PDB Compounds: (B:) Prepilin

SCOPe Domain Sequences for d3fhvb_:

Sequence; same for both SEQRES and ATOM records:

>d3fhvb_ d.24.1.1 (B:) automated matches {Salmonella typhi [TaxId: 601]}
agteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpasgsatlw
nswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikingnnhtd
akvtaeiassectadngrtgtntlvfnyng

Timeline for d3fhvb_:

• d3fhvb_ first appeared in SCOPe 2.01
  
• d3fhvb_ appears in SCOPe 2.02
  
• d3fhvb_ appears in SCOPe 2.04
  
• d3fhvb_ appears in the current release, SCOPe 2.08