Lineage for d3fhva_ (3fhv A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408220Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 1408221Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 1408222Family d.24.1.1: Pilin [54524] (5 proteins)
  6. 1408243Protein automated matches [190127] (3 species)
    not a true protein
  7. 1408253Species Salmonella typhi [TaxId:601] [189084] (2 PDB entries)
  8. 1408254Domain d3fhva_: 3fhv A: [175792]
    automated match to d1q5fa_

Details for d3fhva_

PDB Entry: 3fhv (more details), 1.9 Å

PDB Description: structural basis of salmonella typhi type ivb pils and cystic fibrosis transmembrane conductance regulator (cftr) interaction
PDB Compounds: (A:) Prepilin

SCOPe Domain Sequences for d3fhva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fhva_ d.24.1.1 (A:) automated matches {Salmonella typhi [TaxId: 601]}
agteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpasgsatlw
nswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikingnnhtd
akvtaeiassectadngrtgtntlvfnyng

SCOPe Domain Coordinates for d3fhva_:

Click to download the PDB-style file with coordinates for d3fhva_.
(The format of our PDB-style files is described here.)

Timeline for d3fhva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3fhvb_