SCOP 1.67: Domain d4gssb1: 4gss B:77-209

Lineage for d4gssb1 (4gss B:77-209)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class pi GST [81347] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (36 PDB entries)

8. Domain d4gssb1: 4gss B:77-209 [17571]
   Other proteins in same PDB: d4gssa2, d4gssb2
   complexed with gtx, mes; mutant

Details for d4gssb1

PDB Entry: 4gss, 2.5 Å

PDB Description: human glutathione s-transferase p1-1 y108f mutant

SCOP Domain Sequences for d4gssb1:

Sequence; same for both SEQRES and ATOM records:

>d4gssb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyisliftnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d4gssb1:

• d4gssb1 first appeared (with stable ids) in SCOP 1.55
  
• d4gssb1 appears in SCOP 1.65
  
• d4gssb1 appears in SCOP 1.69
  
• d4gssb1 appears in the current release, SCOPe 2.08