Lineage for d3fc0a_ (3fc0 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1306419Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1306420Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1306421Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1306522Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (4 species)
  7. 1306534Species Mouse (Mus musculus) [TaxId:10090] [158983] (4 PDB entries)
    Uniprot Q7TS55 51-173! Uniprot Q80YG2 49-173
  8. 1306537Domain d3fc0a_: 3fc0 A: [175666]
    automated match to d2q8oa1
    complexed with act

Details for d3fc0a_

PDB Entry: 3fc0 (more details), 1.76 Å

PDB Description: 1.8 a crystal structure of murine gitr ligand dimer expressed in drosophila melanogaster s2 cells
PDB Compounds: (A:) GITR ligand

SCOPe Domain Sequences for d3fc0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fc0a_ b.22.1.1 (A:) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Mouse (Mus musculus) [TaxId: 10090]}
scmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnapfv
vqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntywgiilmpdlp
fis

SCOPe Domain Coordinates for d3fc0a_:

Click to download the PDB-style file with coordinates for d3fc0a_.
(The format of our PDB-style files is described here.)

Timeline for d3fc0a_: