SCOPe 2.08: Domain d3fc0a_: 3fc0 A:

Lineage for d3fc0a_ (3fc0 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [158983] (4 PDB entries)
   Uniprot Q7TS55 51-173! Uniprot Q80YG2 49-173

8. Domain d3fc0a_: 3fc0 A: [175666]
   automated match to d2q8oa1
   complexed with act

Details for d3fc0a_

PDB Entry: 3fc0, 1.76 Å

PDB Description: 1.8 a crystal structure of murine gitr ligand dimer expressed in drosophila melanogaster s2 cells

PDB Compounds: (A:) GITR ligand

SCOPe Domain Sequences for d3fc0a_:

Sequence; same for both SEQRES and ATOM records:

>d3fc0a_ b.22.1.1 (A:) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Mouse (Mus musculus) [TaxId: 10090]}
scmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnapfv
vqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntywgiilmpdlp
fis

Timeline for d3fc0a_:

• d3fc0a_ first appeared in SCOPe 2.01
  
• d3fc0a_ appears in SCOPe 2.07