PDB entry 3fc0

View 3fc0 on RCSB PDB site
Description: 1.8 A crystal structure of murine GITR ligand dimer expressed in Drosophila melanogaster S2 cells
Class: protein binding
Keywords: GITRL; Glucocorticoid-Induced TNF Receptor Ligand, Receptor, PROTEIN BINDING
Deposited on 2008-11-20, released 2008-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GITR ligand
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf18, Gitrl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fc0a_
  • Chain 'B':
    Compound: GITR ligand
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf18, Gitrl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fc0b_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fc0A (A:)
    rshhhhhhssgptaiescmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygq
    vipvdkkyikdnapfvvqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhi
    qktntywgiilmpdlpfis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fc0A (A:)
    scmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnapfv
    vqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntywgiilmpdlp
    fis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fc0B (B:)
    rshhhhhhssgptaiescmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygq
    vipvdkkyikdnapfvvqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhi
    qktntywgiilmpdlpfis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fc0B (B:)
    scmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyipfvvqiy
    kkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntywgiilmpdlpfis