SCOPe 2.03: Domain d3fbka_: 3fbk A:

Lineage for d3fbka_ (3fbk A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.0: automated matches [191388] (1 protein)
   not a true family

6. Protein automated matches [190497] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188711] (6 PDB entries)

8. Domain d3fbka_: 3fbk A: [175663]
   automated match to d1dsya_
   complexed with so4

Details for d3fbka_

PDB Entry: 3fbk, 2 Å

PDB Description: Crystal structure of the C2 domain of the human regulator of G-protein signaling 3 isoform 6 (RGP3), Northeast Structural Genomics Consortium Target HR5550A

PDB Compounds: (A:) Regulator of G-protein signaling 3

SCOPe Domain Sequences for d3fbka_:

Sequence, based on SEQRES records:

>d3fbka_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qgagqlrlsidaqdrvlllhiiegkgliskqpgtcdpyvkislipedsrlrhqktqtvpd
crdpafhehfffpvqeeddqkrllvtvwnrasqsrqsgligcmsfgvkslltpdkeisgw
yyllgehlgrtkhlkvarrr

Sequence, based on observed residues (ATOM records):

>d3fbka_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qgagqlrlsidaqdrvlllhiiegkgliskqpgtcdpyvkislipedsrlrhqktqtvpd
crdpafhehfffpvqeeddqkrllvtvwnrasqsrqsgligcmsfgvkslltkeisgwyy
llgehlgrtkhlkvarrr

Timeline for d3fbka_:

• d3fbka_ first appeared in SCOPe 2.01
  
• d3fbka_ appears in SCOPe 2.02
  
• d3fbka_ appears in SCOPe 2.04
  
• d3fbka_ appears in the current release, SCOPe 2.08