PDB entry 3fbk

View 3fbk on RCSB PDB site
Description: Crystal structure of the C2 domain of the human regulator of G-protein signaling 3 isoform 6 (RGP3), Northeast Structural Genomics Consortium Target HR5550A
Class: signaling protein
Keywords: all beta-sheet fold, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Alternative splicing, Cell membrane, Cytoplasm, Membrane, Nucleus, Phosphoprotein, Signal transduction inhibitor, SIGNALING PROTEIN
Deposited on 2008-11-19, released 2008-12-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2008-12-02, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of G-protein signaling 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3fbka_
  • Chain 'B':
    Compound: Regulator of G-protein signaling 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3fbkb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fbkA (A:)
    mghhhhhhshkvqgagqlrlsidaqdrvlllhiiegkgliskqpgtcdpyvkislipeds
    rlrhqktqtvpdcrdpafhehfffpvqeeddqkrllvtvwnrasqsrqsgligcmsfgvk
    slltpdkeisgwyyllgehlgrtkhlkvarrrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fbkA (A:)
    qgagqlrlsidaqdrvlllhiiegkgliskqpgtcdpyvkislipedsrlrhqktqtvpd
    crdpafhehfffpvqeeddqkrllvtvwnrasqsrqsgligcmsfgvkslltkeisgwyy
    llgehlgrtkhlkvarrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fbkB (B:)
    mghhhhhhshkvqgagqlrlsidaqdrvlllhiiegkgliskqpgtcdpyvkislipeds
    rlrhqktqtvpdcrdpafhehfffpvqeeddqkrllvtvwnrasqsrqsgligcmsfgvk
    slltpdkeisgwyyllgehlgrtkhlkvarrrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fbkB (B:)
    vqgagqlrlsidaqdrvlllhiiegkgliskqpgtcdpyvkislipedsrlrhqktqtvp
    dcrdpafhehfffpvqeeddqkrllvtvwnrasqsrqsgligcmsfgvksllteisgwyy
    llgehlgrtkhlkvarrr