Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
Family a.25.3.1: ESAT-6 like [140454] (3 proteins) Pfam PF06013; the conserwed WxG motif makes the turn at the alpha-hairpin tip |
Protein ESAT-6, EsxA [140457] (1 species) 6 kDa early secretory antigenic target |
Species Mycobacterium tuberculosis [TaxId:1773] [140458] (2 PDB entries) Uniprot P0A564 1-94 |
Domain d3favd_: 3fav D: [175629] Other proteins in same PDB: d3fava_, d3favc_ automated match to d1wa8b1 complexed with imd, zn |
PDB Entry: 3fav (more details), 2.15 Å
SCOPe Domain Sequences for d3favd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3favd_ a.25.3.1 (D:) ESAT-6, EsxA {Mycobacterium tuberculosis [TaxId: 1773]} nfagieaaasaiqgnvtsihslldegkqsltklaaawggsgseayqgvqqkwdatateln nalqnlartiseagqama
Timeline for d3favd_: