Lineage for d3favd_ (3fav D:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1085854Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 1085855Family a.25.3.1: ESAT-6 like [140454] (3 proteins)
    Pfam PF06013; the conserwed WxG motif makes the turn at the alpha-hairpin tip
  6. 1085859Protein ESAT-6, EsxA [140457] (1 species)
    6 kDa early secretory antigenic target
  7. 1085860Species Mycobacterium tuberculosis [TaxId:1773] [140458] (2 PDB entries)
    Uniprot P0A564 1-94
  8. 1085862Domain d3favd_: 3fav D: [175629]
    Other proteins in same PDB: d3fava_, d3favc_
    automated match to d1wa8b1
    complexed with imd, zn

Details for d3favd_

PDB Entry: 3fav (more details), 2.15 Å

PDB Description: Structure of the CFP10-ESAT6 complex from Mycobacterium tuberculosis
PDB Compounds: (D:) 6 kDa early secretory antigenic target

SCOPe Domain Sequences for d3favd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3favd_ a.25.3.1 (D:) ESAT-6, EsxA {Mycobacterium tuberculosis [TaxId: 1773]}
nfagieaaasaiqgnvtsihslldegkqsltklaaawggsgseayqgvqqkwdatateln
nalqnlartiseagqama

SCOPe Domain Coordinates for d3favd_:

Click to download the PDB-style file with coordinates for d3favd_.
(The format of our PDB-style files is described here.)

Timeline for d3favd_: