Class a: All alpha proteins [46456] (285 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
Family a.25.3.1: ESAT-6 like [140454] (3 proteins) Pfam PF06013; the conserwed WxG motif makes the turn at the alpha-hairpin tip |
Protein automated matches [191103] (1 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [189126] (1 PDB entry) |
Domain d3favc_: 3fav C: [175628] Other proteins in same PDB: d3favb_, d3favd_ automated match to d1wa8a1 complexed with imd, zn |
PDB Entry: 3fav (more details), 2.15 Å
SCOPe Domain Sequences for d3favc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3favc_ a.25.3.1 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} maemktdaatlaqeagnferisgdlktqidqvestagslqgqwrgaagtaaqaavvrfqe aankqkqeldeistnirqagvqysradeeq
Timeline for d3favc_: