Lineage for d1aqxa1 (1aqx A:77-209)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153151Species Human (Homo sapiens), class pi [TaxId:9606] [47619] (33 PDB entries)
  8. 153203Domain d1aqxa1: 1aqx A:77-209 [17562]
    Other proteins in same PDB: d1aqxa2, d1aqxb2, d1aqxc2, d1aqxd2

Details for d1aqxa1

PDB Entry: 1aqx (more details), 2 Å

PDB Description: glutathione s-transferase in complex with meisenheimer complex

SCOP Domain Sequences for d1aqxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqxa1 a.45.1.1 (A:77-209) Glutathione S-transferase {Human (Homo sapiens), class pi}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d1aqxa1:

Click to download the PDB-style file with coordinates for d1aqxa1.
(The format of our PDB-style files is described here.)

Timeline for d1aqxa1: