Lineage for d3fa8b_ (3fa8 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1132927Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1132928Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1133328Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1133376Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 1133383Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (30 PDB entries)
  8. 1133411Domain d3fa8b_: 3fa8 B: [175610]
    automated match to d1bm5a_
    mutant

Details for d3fa8b_

PDB Entry: 3fa8 (more details), 1.78 Å

PDB Description: crystal structure of the apo r132k:y134f:r111l:l121e mutant of cellular retinoic acid-binding protein ii at 1.78 angstrom resolution
PDB Compounds: (B:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d3fa8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fa8b_ b.60.1.2 (B:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
etmtaddvvctkvfvre

SCOPe Domain Coordinates for d3fa8b_:

Click to download the PDB-style file with coordinates for d3fa8b_.
(The format of our PDB-style files is described here.)

Timeline for d3fa8b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3fa8a_