Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (18 species) not a true protein |
Species Desulfovibrio desulfuricans [TaxId:876] [188896] (3 PDB entries) |
Domain d3f6sa_: 3f6s A: [175518] automated match to d1j9ea_ complexed with fmn |
PDB Entry: 3f6s (more details), 2.5 Å
SCOPe Domain Sequences for d3f6sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f6sa_ c.23.5.0 (A:) automated matches {Desulfovibrio desulfuricans [TaxId: 876]} skvlivfgsstgntesiaqkleeliaagghevtllnaadasaenladgydavlfgcsawg medlemqddflslfeefdriglagrkvaafasgdqeyehfcgavpaieerakelgatiia eglkmegdasndpeavasfaedvlkql
Timeline for d3f6sa_: