Lineage for d16gsb1 (16gs B:77-209)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641765Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 641766Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 641767Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 642036Protein Class pi GST [81347] (4 species)
  7. 642037Species Human (Homo sapiens) [TaxId:9606] [47619] (39 PDB entries)
  8. 642084Domain d16gsb1: 16gs B:77-209 [17549]
    Other proteins in same PDB: d16gsa2, d16gsb2
    complexed with mes, so4

Details for d16gsb1

PDB Entry: 16gs (more details), 1.9 Å

PDB Description: glutathione s-transferase p1-1 apo form 3
PDB Compounds: (B:) glutathione s-transferase

SCOP Domain Sequences for d16gsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d16gsb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d16gsb1:

Click to download the PDB-style file with coordinates for d16gsb1.
(The format of our PDB-style files is described here.)

Timeline for d16gsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d16gsb2