Lineage for d16gsb1 (16gs B:77-209)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3768Species Human (Homo sapiens), class pi [TaxId:9606] [47619] (30 PDB entries)
  8. 3803Domain d16gsb1: 16gs B:77-209 [17549]
    Other proteins in same PDB: d16gsa2, d16gsb2

Details for d16gsb1

PDB Entry: 16gs (more details), 1.9 Å

PDB Description: glutathione s-transferase p1-1 apo form 3

SCOP Domain Sequences for d16gsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d16gsb1 a.45.1.1 (B:77-209) Glutathione S-transferase {Human (Homo sapiens), class pi}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d16gsb1:

Click to download the PDB-style file with coordinates for d16gsb1.
(The format of our PDB-style files is described here.)

Timeline for d16gsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d16gsb2