SCOPe 2.06: Domain d3f1cb1: 3f1c B:2-234

Lineage for d3f1cb1 (3f1c B:2-234)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.0: automated matches [191551] (1 protein)
   not a true family

6. Protein automated matches [190951] (26 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:265669] [188669] (1 PDB entry)

8. Domain d3f1cb1: 3f1c B:2-234 [175405]
   Other proteins in same PDB: d3f1ca2, d3f1cb2
   automated match to d1vpaa_

Details for d3f1cb1

PDB Entry: 3f1c, 2.3 Å

PDB Description: crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase from listeria monocytogenes

PDB Compounds: (B:) Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2

SCOPe Domain Sequences for d3f1cb1:

Sequence, based on SEQRES records:

>d3f1cb1 c.68.1.0 (B:2-234) automated matches {Listeria monocytogenes [TaxId: 265669]}
iyaqilaggkgtrmgnvsmpkqflplngkpiivhtvekfilntrfdkilisspkewmnha
ednikkyisddrivvieggedrnetimngirfvektygltdddiivthdavrpflthrii
eenidaaletgavdtviealdtivessnhevitdipvrdhmyqgqtpqsfnmkkvfnhyq
nltpekkqiltdackicllagddvklvkgeifnikittpydlkvanaiiqeri

Sequence, based on observed residues (ATOM records):

>d3f1cb1 c.68.1.0 (B:2-234) automated matches {Listeria monocytogenes [TaxId: 265669]}
iyaqilagmgnvsmpkqflplngkpiivhtvekfilntrfdkilisspkewmnhaednik
kyisddrivvieggedrnetimngirfvektygltdddiivthdavrpflthriieenid
aaletgavdtviealdtivessnhevitdipvrdhmyqgqtpqsfnmkkvfnhyqnltpe
kkqiltdackicllagddvklvkgeifnikittpydlkvanaiiqeri

Timeline for d3f1cb1:

• d3f1cb1 first appeared in SCOPe 2.01, called d3f1cb_
  
• d3f1cb1 was called d3f1cb_ in SCOPe 2.05
  
• d3f1cb1 appears in SCOPe 2.07
  
• d3f1cb1 appears in the current release, SCOPe 2.08