Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.0: automated matches [191551] (1 protein) not a true family |
Protein automated matches [190951] (10 species) not a true protein |
Species Listeria monocytogenes [TaxId:265669] [188669] (1 PDB entry) |
Domain d3f1cb_: 3f1c B: [175405] automated match to d1vpaa_ |
PDB Entry: 3f1c (more details), 2.3 Å
SCOPe Domain Sequences for d3f1cb_:
Sequence, based on SEQRES records: (download)
>d3f1cb_ c.68.1.0 (B:) automated matches {Listeria monocytogenes [TaxId: 265669]} sliyaqilaggkgtrmgnvsmpkqflplngkpiivhtvekfilntrfdkilisspkewmn haednikkyisddrivvieggedrnetimngirfvektygltdddiivthdavrpflthr iieenidaaletgavdtviealdtivessnhevitdipvrdhmyqgqtpqsfnmkkvfnh yqnltpekkqiltdackicllagddvklvkgeifnikittpydlkvanaiiqeri
>d3f1cb_ c.68.1.0 (B:) automated matches {Listeria monocytogenes [TaxId: 265669]} sliyaqilagmgnvsmpkqflplngkpiivhtvekfilntrfdkilisspkewmnhaedn ikkyisddrivvieggedrnetimngirfvektygltdddiivthdavrpflthriieen idaaletgavdtviealdtivessnhevitdipvrdhmyqgqtpqsfnmkkvfnhyqnlt pekkqiltdackicllagddvklvkgeifnikittpydlkvanaiiqeri
Timeline for d3f1cb_: