| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
| Protein Class pi GST [81347] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47619] (41 PDB entries) |
| Domain d13gsb1: 13gs B:77-209 [17531] Other proteins in same PDB: d13gsa2, d13gsb2 complexed with gsh, mes, sas |
PDB Entry: 13gs (more details), 1.9 Å
SCOPe Domain Sequences for d13gsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d13gsb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq
Timeline for d13gsb1: