Class a: All alpha proteins [46456] (171 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins) |
Protein Class pi GST [81347] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [47619] (33 PDB entries) |
Domain d2pgta1: 2pgt A:77-209 [17526] Other proteins in same PDB: d2pgta2, d2pgtb2 |
PDB Entry: 2pgt (more details), 1.9 Å
SCOP Domain Sequences for d2pgta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pgta1 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens)} glygkdqqeaalvdmvndgvedlrckyvsliytnyeagkddyvkalpgqlkpfetllsqn qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp eyvnlpingngkq
Timeline for d2pgta1: