Lineage for d3eu5b_ (3eu5 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004426Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2004554Family a.102.4.3: Protein prenyltransferases [48246] (3 protein domains)
  6. 2004695Protein automated matches [191067] (1 species)
    not a true protein
  7. 2004696Species Norway rat (Rattus norvegicus) [TaxId:10116] [188971] (2 PDB entries)
  8. 2004697Domain d3eu5b_: 3eu5 B: [175219]
    Other proteins in same PDB: d3eu5a_
    automated match to d1jcqb_
    complexed with gbo, zn

Details for d3eu5b_

PDB Entry: 3eu5 (more details), 2.8 Å

PDB Description: Crystal structure of FTase(ALPHA-subunit; BETA-subunit DELTA C10) in complex with BiotinGPP
PDB Compounds: (B:) Protein farnesyltransferase subunit beta

SCOPe Domain Sequences for d3eu5b_:

Sequence, based on SEQRES records: (download)

>d3eu5b_ a.102.4.3 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
plyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhy
lkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfg
ggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdv
rsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvi
lkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdp
alsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgam
lhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgfee

Sequence, based on observed residues (ATOM records): (download)

>d3eu5b_ a.102.4.3 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
plyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhrlvlqrekhfhylkr
glrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgggp
gqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvrsa
ycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvilkk
erslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpals
mshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgamlhd
vvmgvpenvlqpthpvynigpdkviqatthflqkpvpgfee

SCOPe Domain Coordinates for d3eu5b_:

Click to download the PDB-style file with coordinates for d3eu5b_.
(The format of our PDB-style files is described here.)

Timeline for d3eu5b_: