Lineage for d3etma_ (3etm A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194363Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2194613Protein automated matches [190032] (18 species)
    not a true protein
  7. 2194614Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)
  8. 2194635Domain d3etma_: 3etm A: [175214]
    Other proteins in same PDB: d3etmb2
    automated match to d2b8pa1
    complexed with cdp, mg; mutant

Details for d3etma_

PDB Entry: 3etm (more details), 1.9 Å

PDB Description: crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with cdp
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3etma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etma_ d.58.6.1 (A:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
lcdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandigenlihasdse
dsavdeisiwfpe

SCOPe Domain Coordinates for d3etma_:

Click to download the PDB-style file with coordinates for d3etma_.
(The format of our PDB-style files is described here.)

Timeline for d3etma_: