Lineage for d3esxb_ (3esx B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102351Family c.23.5.1: Flavodoxin-related [52219] (6 protein domains)
    binds FMN
  6. 2102463Protein automated matches [190443] (6 species)
    not a true protein
  7. 2102464Species Anabaena sp. [TaxId:1168] [188238] (5 PDB entries)
  8. 2102470Domain d3esxb_: 3esx B: [175202]
    automated match to d1rcfa_
    complexed with ca, cl, fmn

Details for d3esxb_

PDB Entry: 3esx (more details), 2.31 Å

PDB Description: e16ke61kd126kd150k flavodoxin from anabaena
PDB Compounds: (B:) flavodoxin

SCOPe Domain Sequences for d3esxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3esxb_ c.23.5.1 (B:) automated matches {Anabaena sp. [TaxId: 1168]}
skkiglfygtqtgktksvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
klqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
stdgykfndskalrngkfvglaldednqskltddrikswvaqlksefgl

SCOPe Domain Coordinates for d3esxb_:

Click to download the PDB-style file with coordinates for d3esxb_.
(The format of our PDB-style files is described here.)

Timeline for d3esxb_: