SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3esxb_ (3esx B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102351Family c.23.5.1: Flavodoxin-related [52219] (6 protein domains)
    binds FMN
  6. 2102463Protein automated matches [190443] (4 species)
    not a true protein
  7. 2102464Species Anabaena sp. [TaxId:1168] [188238] (5 PDB entries)
  8. 2102470Domain d3esxb_: 3esx B: [175202]
    automated match to d1rcfa_
    complexed with ca, cl, fmn

Details for d3esxb_

PDB Entry: 3esx (more details), 2.31 Å

PDB Description: e16ke61kd126kd150k flavodoxin from anabaena
PDB Compounds: (B:) flavodoxin

SCOPe Domain Sequences for d3esxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3esxb_ c.23.5.1 (B:) automated matches {Anabaena sp. [TaxId: 1168]}
skkiglfygtqtgktksvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
klqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
stdgykfndskalrngkfvglaldednqskltddrikswvaqlksefgl

SCOPe Domain Coordinates for d3esxb_:

Click to download the PDB-style file with coordinates for d3esxb_.
(The format of our PDB-style files is described here.)

Timeline for d3esxb_: