SCOPe 2.01: Domain d3ernc_: 3ern C:

Lineage for d3ernc_ (3ern C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)

7. Species Escherichia coli K-12 [TaxId:83333] [188969] (4 PDB entries)

8. Domain d3ernc_: 3ern C: [175170]
   automated match to d1h48c_
   complexed with car, gpp, so4, zn

Details for d3ernc_

PDB Entry: 3ern, 2.1 Å

PDB Description: Crystal structure of 2C-methyl-D-erythritol 2,4-clycodiphosphate synthase complexed with AraCMP

PDB Compounds: (C:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d3ernc_:

Sequence, based on SEQRES records:

>d3ernc_ d.79.5.1 (C:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli K-12 [TaxId: 83333]}
emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk
lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed
lgchmddvnvkattteklgftgrgegiaceavallik

Sequence, based on observed residues (ATOM records):

>d3ernc_ d.79.5.1 (C:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli K-12 [TaxId: 83333]}
emrighgfdvhafggegpiiiggvripyesdgdvalhaltdallgaaalgdigklfpdtd
pafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedlgchmd
dvnvkattteklgftgrgegiaceavallik

Timeline for d3ernc_:

• d3ernc_ is new in SCOPe 2.01-stable
  
• d3ernc_ appears in SCOPe 2.02
  
• d3ernc_ appears in the current release, SCOPe 2.08, called d3ernc1