Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (86 species) not a true protein |
Species Colwellia psychrerythraea [TaxId:167879] [188634] (1 PDB entry) |
Domain d3eqza1: 3eqz A:3-125 [175164] Other proteins in same PDB: d3eqza2, d3eqzb2 automated match to d1nxoa_ |
PDB Entry: 3eqz (more details), 2.15 Å
SCOPe Domain Sequences for d3eqza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eqza1 c.23.1.0 (A:3-125) automated matches {Colwellia psychrerythraea [TaxId: 167879]} nrvfivdddtltcnllktivepifgnveafqhprafltlslnkqdiiildlmmpdmdgie virhlaehkspaslilisgydsgvlhsaetlalscglnvintftkpintevltcfltsls nrq
Timeline for d3eqza1: