Lineage for d1nxoa_ (1nxo A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. Protein DNA-binding response regulator MicA, N-terminal domain [102232] (1 species)
  7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [102233] (13 PDB entries)
  8. Domain d1nxoa_: 1nxo A: [92306]

Details for d1nxoa_

PDB Entry: 1nxo (more details), 1.85 Å

PDB Description: MicArec pH7.0
PDB Compounds: (A:) DNA-binding response regulator

SCOPe Domain Sequences for d1nxoa_:

Sequence, based on SEQRES records: (download)

>d1nxoa_ c.23.1.1 (A:) DNA-binding response regulator MicA, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
kkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidgl
evaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrrsq

Sequence, based on observed residues (ATOM records): (download)

>d1nxoa_ c.23.1.1 (A:) DNA-binding response regulator MicA, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
kkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmidgleva
ktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrrsq

SCOPe Domain Coordinates for d1nxoa_ are not available.

Timeline for d1nxoa_: