SCOP 1.75: Domain d1pgtb1: 1pgt B:77-209

Lineage for d1pgtb1 (1pgt B:77-209)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (41 PDB entries)

8. Domain d1pgtb1: 1pgt B:77-209 [17516]
   Other proteins in same PDB: d1pgta2, d1pgtb2
   complexed with epe, gtx; mutant

Details for d1pgtb1

PDB Entry: 1pgt, 1.8 Å

PDB Description: crystal structure of human glutathione s-transferase p1-1[v104] complexed with s-hexylglutathione

PDB Compounds: (B:) glutathione s-transferase

SCOP Domain Sequences for d1pgtb1:

Sequence; same for both SEQRES and ATOM records:

>d1pgtb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyvsliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d1pgtb1:

• d1pgtb1 first appeared (with stable ids) in SCOP 1.55
  
• d1pgtb1 appears in SCOP 1.73
  
• d1pgtb1 appears in SCOPe 2.01
  
• d1pgtb1 appears in the current release, SCOPe 2.08