Lineage for d3eqaa_ (3eqa A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007005Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2007006Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2007007Family a.102.1.1: Glucoamylase [48209] (2 proteins)
    automatically mapped to Pfam PF00723
  6. 2007020Protein automated matches [191093] (1 species)
    not a true protein
  7. 2007021Species Aspergillus niger [TaxId:5061] [189072] (1 PDB entry)
  8. 2007022Domain d3eqaa_: 3eqa A: [175154]
    automated match to d1agma_
    complexed with gol, man, trs

Details for d3eqaa_

PDB Entry: 3eqa (more details), 1.9 Å

PDB Description: catalytic domain of glucoamylase from aspergillus niger complexed with tris and glycerol
PDB Compounds: (A:) glucoamylase

SCOPe Domain Sequences for d3eqaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eqaa_ a.102.1.1 (A:) automated matches {Aspergillus niger [TaxId: 5061]}
wlsneatvartailnnigadgawvsgadsgivvaspstdnpdyfytwtrdsglvlktlvd
lfrngdtsllstienyisaqaivqgisnpsgdlssgaglgepkfnvdetaytgswgrpqr
dgpalratamigfgqwlldngytstatdivwplvrndlsyvaqywnqtgydlweevngss
fftiavqhralvegsafatavgsscswcdsqapeilcylqsfwtgsfilanfdssrsgkd
antllgsihtfdpeaacddstfqpcspralanhkevvdsfrsiytlndglsdseavavgr
ypedtyyngnpwflctlaaaeqlydalyqwdkqgslevtdvsldffkalysdaatgtyss
ssstyssivdavktfadgfvsivethaasngsmseqydksdgeqlsardltwsyaallta
nnrrnsvvpaswgetsassvpgtcaatsaigtyssvtv

SCOPe Domain Coordinates for d3eqaa_:

Click to download the PDB-style file with coordinates for d3eqaa_.
(The format of our PDB-style files is described here.)

Timeline for d3eqaa_: