Class a: All alpha proteins [46456] (289 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) |
Family a.102.1.1: Glucoamylase [48209] (2 proteins) automatically mapped to Pfam PF00723 |
Protein automated matches [191093] (1 species) not a true protein |
Species Aspergillus niger [TaxId:5061] [189072] (1 PDB entry) |
Domain d3eqaa_: 3eqa A: [175154] automated match to d1agma_ complexed with gol, man, trs |
PDB Entry: 3eqa (more details), 1.9 Å
SCOPe Domain Sequences for d3eqaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eqaa_ a.102.1.1 (A:) automated matches {Aspergillus niger [TaxId: 5061]} wlsneatvartailnnigadgawvsgadsgivvaspstdnpdyfytwtrdsglvlktlvd lfrngdtsllstienyisaqaivqgisnpsgdlssgaglgepkfnvdetaytgswgrpqr dgpalratamigfgqwlldngytstatdivwplvrndlsyvaqywnqtgydlweevngss fftiavqhralvegsafatavgsscswcdsqapeilcylqsfwtgsfilanfdssrsgkd antllgsihtfdpeaacddstfqpcspralanhkevvdsfrsiytlndglsdseavavgr ypedtyyngnpwflctlaaaeqlydalyqwdkqgslevtdvsldffkalysdaatgtyss ssstyssivdavktfadgfvsivethaasngsmseqydksdgeqlsardltwsyaallta nnrrnsvvpaswgetsassvpgtcaatsaigtyssvtv
Timeline for d3eqaa_: