Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.70: Nucleoside hydrolase [53589] (1 superfamily) core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest |
Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) |
Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins) automatically mapped to Pfam PF01156 |
Protein automated matches [190287] (2 species) not a true protein |
Species Trypanosoma vivax [TaxId:5699] [187091] (5 PDB entries) |
Domain d3epxb_: 3epx B: [175151] automated match to d1hoza_ complexed with ca, gol, imq |
PDB Entry: 3epx (more details), 1.85 Å
SCOPe Domain Sequences for d3epxb_:
Sequence, based on SEQRES records: (download)
>d3epxb_ c.70.1.1 (B:) automated matches {Trypanosoma vivax [TaxId: 5699]} aknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm wamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaen ypltfvarnpeaeffldmllrsarac
>d3epxb_ c.70.1.1 (B:) automated matches {Trypanosoma vivax [TaxId: 5699]} aknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm wamcthcellrdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenyp ltfvarnpeaeffldmllrsarac
Timeline for d3epxb_: