Lineage for d3epxb_ (3epx B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136733Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2136734Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2136735Family c.70.1.1: Nucleoside hydrolase [53591] (5 protein domains)
    automatically mapped to Pfam PF01156
  6. 2136776Protein automated matches [190287] (3 species)
    not a true protein
  7. 2136789Species Trypanosoma vivax [TaxId:5699] [187091] (5 PDB entries)
  8. 2136795Domain d3epxb_: 3epx B: [175151]
    automated match to d1hoza_
    complexed with ca, gol, imq

Details for d3epxb_

PDB Entry: 3epx (more details), 1.85 Å

PDB Description: Crystal structure of Trypanosoma vivax nucleoside hydrolase in complex with the inhibitor (2R,3R,4S)-2-(hydroxymethyl)-1-(quinolin-8-ylmethyl)pyrrolidin-3,4-diol
PDB Compounds: (B:) IAG-nucleoside hydrolase

SCOPe Domain Sequences for d3epxb_:

Sequence, based on SEQRES records: (download)

>d3epxb_ c.70.1.1 (B:) automated matches {Trypanosoma vivax [TaxId: 5699]}
aknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm
nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll
adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg
taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm
wamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaen
ypltfvarnpeaeffldmllrsarac

Sequence, based on observed residues (ATOM records): (download)

>d3epxb_ c.70.1.1 (B:) automated matches {Trypanosoma vivax [TaxId: 5699]}
aknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm
nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll
adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg
taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm
wamcthcellrdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenyp
ltfvarnpeaeffldmllrsarac

SCOPe Domain Coordinates for d3epxb_:

Click to download the PDB-style file with coordinates for d3epxb_.
(The format of our PDB-style files is described here.)

Timeline for d3epxb_: