Lineage for d3enja_ (3enj A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722943Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2722944Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2722945Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2722946Protein Citrate synthase [48258] (7 species)
  7. 2722991Species Pig (Sus scrofa) [TaxId:9823] [48260] (4 PDB entries)
  8. 2722992Domain d3enja_: 3enj A: [175100]
    automated match to d1ctsa_
    complexed with cl, cys, so4

Details for d3enja_

PDB Entry: 3enj (more details), 1.78 Å

PDB Description: structure of pig heart citrate synthase at 1.78 a resolution
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d3enja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3enja_ a.103.1.1 (A:) Citrate synthase {Pig (Sus scrofa) [TaxId: 9823]}
asstnlkdiladlipkeqariktfrqqhgntvvgqitvdmmyggmrgmkglvyetsvldp
degirfrgysipecqkmlpkakggeeplpeglfwllvtgqipteeqvswlskewakraal
pshvvtmldnfptnlhpmsqlsaaitalnsesnfarayaegihrtkyweliyedcmdlia
klpcvaakiyrnlyregssigaidskldwshnftnmlgytdaqftelmrlyltihsdheg
gnvsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdek
lrdyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlphdpmfklvaqlykivpnv
lleqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfple
rpksmstdgliklvdsk

SCOPe Domain Coordinates for d3enja_:

Click to download the PDB-style file with coordinates for d3enja_.
(The format of our PDB-style files is described here.)

Timeline for d3enja_: