Lineage for d3elza1 (3elz A:1-130)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2415089Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2415090Protein automated matches [190698] (25 species)
    not a true protein
  7. 2415293Species Zebrafish (Danio rerio) [TaxId:7955] [188731] (3 PDB entries)
  8. 2415295Domain d3elza1: 3elz A:1-130 [175066]
    Other proteins in same PDB: d3elza2, d3elzb2, d3elzb3, d3elzc2, d3elzc3
    automated match to d1o1ua_
    complexed with chd

Details for d3elza1

PDB Entry: 3elz (more details), 2.2 Å

PDB Description: Crystal structure of Zebrafish Ileal Bile Acid-Bindin Protein complexed with cholic acid (crystal form A).
PDB Compounds: (A:) Ileal bile acid-binding protein

SCOPe Domain Sequences for d3elza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3elza1 b.60.1.0 (A:1-130) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
afngkwetesqegyepfckligipddviakgrdfklvteivqngddftwtqyypnnhvvt
nkfivgkesdmetvggkkfkgivsmeggkltisfpkyqqtteisggklvetstasgaqgt
avlvrtskkv

SCOPe Domain Coordinates for d3elza1:

Click to download the PDB-style file with coordinates for d3elza1.
(The format of our PDB-style files is described here.)

Timeline for d3elza1: