Lineage for d3ek9a_ (3ek9 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119627Family b.29.1.22: SPRY domain [141154] (6 proteins)
    Pfam PF00622
  6. 1119645Protein SPRY domain-containing SOCS box protein 2 [141159] (1 species)
  7. 1119646Species Mouse (Mus musculus) [TaxId:10090] [141160] (2 PDB entries)
    Uniprot O88838 12-224
  8. 1119647Domain d3ek9a_: 3ek9 A: [175008]
    automated match to d2afja1
    complexed with gol

Details for d3ek9a_

PDB Entry: 3ek9 (more details), 2.6 Å

PDB Description: SPRY Domain-containing SOCS Box Protein 2: Crystal Structure and Residues Critical for Protein Binding
PDB Compounds: (A:) SPRY domain-containing SOCS box protein 2

SCOPe Domain Sequences for d3ek9a_:

Sequence, based on SEQRES records: (download)

>d3ek9a_ b.29.1.22 (A:) SPRY domain-containing SOCS box protein 2 {Mouse (Mus musculus) [TaxId: 10090]}
sdfsppegleellsapppdlvaqrhhgwnpkdcsenidvkegglcferrpvaqstdgvrg
krgysrglhaweiswpleqrgthavvgvatalaplqadhyaallgsnseswgwdigrgkl
yhqskgleapqypagpqgeqlvvperllvvldmeegtlgysiggtylgpafrglkgrtly
psvsavwgqcqvrirymge

Sequence, based on observed residues (ATOM records): (download)

>d3ek9a_ b.29.1.22 (A:) SPRY domain-containing SOCS box protein 2 {Mouse (Mus musculus) [TaxId: 10090]}
sdfsppegleellsapppdlvaqrhhgwnpkdcsenidvkegglcferrpvaqstdgvrg
krgysrglhaweiswpleqrgthavvgvatalaplqadhyaallgsnseswgwdigrgkl
yhqskapqypageqlvvperllvvldmeegtlgysiggtylgpafrglkgrtlypsvsav
wgqcqvrirymge

SCOPe Domain Coordinates for d3ek9a_:

Click to download the PDB-style file with coordinates for d3ek9a_.
(The format of our PDB-style files is described here.)

Timeline for d3ek9a_: