Class a: All alpha proteins [46456] (285 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein automated matches [190501] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187941] (5 PDB entries) |
Domain d3ejja_: 3ejj A: [174984] automated match to d1hmca_ |
PDB Entry: 3ejj (more details), 2.4 Å
SCOPe Domain Sequences for d3ejja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ejja_ a.26.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} adpsehcshmignghlkvlqqlidsqmetscqiafefvdqeqlddpvcylkkafflvqdi idetmrfkdntpnanaterlqelsnnlnscftkdyeeqnkacvrtfhetplqllekiknf fnetknllekdwniftkncnnsfakcss
Timeline for d3ejja_: