Lineage for d3eg6a_ (3eg6 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2809156Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2809157Protein automated matches [190568] (11 species)
    not a true protein
  7. 2809207Species Human (Homo sapiens) [TaxId:9606] [187559] (94 PDB entries)
  8. 2809288Domain d3eg6a_: 3eg6 A: [174919]
    automated match to d1vyhc1
    complexed with so4

Details for d3eg6a_

PDB Entry: 3eg6 (more details), 1.72 Å

PDB Description: structure of wdr5 bound to mll1 peptide
PDB Compounds: (A:) WD repeat-containing protein 5

SCOPe Domain Sequences for d3eg6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eg6a_ b.69.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgi
sdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfd
esvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktli
dddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtg
gkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklw
ksdc

SCOPe Domain Coordinates for d3eg6a_:

Click to download the PDB-style file with coordinates for d3eg6a_.
(The format of our PDB-style files is described here.)

Timeline for d3eg6a_: