SCOPe 2.06: Domain d3eeja1: 3eej A:3-217

Lineage for d3eeja1 (3eej A:3-217)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (21 species)
   not a true protein

7. Species Candida glabrata [TaxId:5478] [188965] (7 PDB entries)

8. Domain d3eeja1: 3eej A:3-217 [174893]
   Other proteins in same PDB: d3eeja2, d3eejb2
   automated match to d1ai9a_
   complexed with 53r, ndp

Details for d3eeja1

PDB Entry: 3eej, 2.11 Å

PDB Description: candida glabrata dihydrofolate reductase complexed with 2,4-diamino-5- [3-methyl-3-(3-methoxy-5-phenylphenyl)prop-1-ynyl]-6- methylpyrimidine(ucp111d) and nadph

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3eeja1:

Sequence; same for both SEQRES and ATOM records:

>d3eeja1 c.71.1.0 (A:3-217) automated matches {Candida glabrata [TaxId: 5478]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkk

Timeline for d3eeja1:

• d3eeja1 first appeared in SCOPe 2.01, called d3eeja_
  
• d3eeja1 was called d3eeja_ in SCOPe 2.05
  
• d3eeja1 appears in SCOPe 2.07
  
• d3eeja1 appears in the current release, SCOPe 2.08