Lineage for d3ee8a_ (3ee8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010233Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 3010234Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 3010235Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 3010240Protein automated matches [190936] (7 species)
    not a true protein
  7. 3010248Species Influenza A virus (a/udorn/307/1972(h3n2)) [TaxId:381517] [188730] (12 PDB entries)
  8. 3010270Domain d3ee8a_: 3ee8 A: [174883]
    automated match to d2gx9a1

Details for d3ee8a_

PDB Entry: 3ee8 (more details), 2.6 Å

PDB Description: structure of ns1 effector domain
PDB Compounds: (A:) Non-structural protein 1

SCOPe Domain Sequences for d3ee8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ee8a_ d.299.1.1 (A:) automated matches {Influenza A virus (a/udorn/307/1972(h3n2)) [TaxId: 381517]}
tpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrlet
lillrafteegaivgeisplpsfpghtiedvknaigvligglewndntvrvsktlqrfaw
gs

SCOPe Domain Coordinates for d3ee8a_:

Click to download the PDB-style file with coordinates for d3ee8a_.
(The format of our PDB-style files is described here.)

Timeline for d3ee8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ee8b_