SCOPe 2.04: Domain d3ee3d_: 3ee3 D:

Lineage for d3ee3d_ (3ee3 D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (13 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)

8. Domain d3ee3d_: 3ee3 D: [174873]
   automated match to d2b8pa1
   complexed with cdp, mg

Details for d3ee3d_

PDB Entry: 3ee3, 2.4 Å

PDB Description: Crystal structure of Acanthamoeba polyphaga mimivirus nucleoside diphosphate kinase complexed with CDP

PDB Compounds: (D:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3ee3d_:

Sequence; same for both SEQRES and ATOM records:

>d3ee3d_ d.58.6.1 (D:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
glqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyf
ndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdseds
avdeisiwfpet

Timeline for d3ee3d_:

• d3ee3d_ first appeared in SCOPe 2.01
  
• d3ee3d_ appears in SCOPe 2.03
  
• d3ee3d_ appears in SCOPe 2.05
  
• d3ee3d_ appears in the current release, SCOPe 2.08, called d3ee3d1