SCOPe 2.07: Domain d3eaeb_: 3eae B:

Lineage for d3eaeb_ (3eae B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.2: PWWP domain [69250] (6 proteins)
   includes the C-terminal all-alpha subdomain

6. Protein automated matches [190966] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188600] (18 PDB entries)

8. Domain d3eaeb_: 3eae B: [174804]
   automated match to d1n27a_

Details for d3eaeb_

PDB Entry: 3eae, 2.24 Å

PDB Description: pwwp domain of human hepatoma-derived growth factor 2 (hdgf2)

PDB Compounds: (B:) Hepatoma-derived growth factor-related protein 2

SCOPe Domain Sequences for d3eaeb_:

Sequence, based on SEQRES records:

>d3eaeb_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fkpgdlvfakmkgyphwpariddiadgavkpppnkypifffgthetaflgpkdlfpydkc
kdkygkpnkrkgfneglweiqnnpha

Sequence, based on observed residues (ATOM records):

>d3eaeb_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fkpgdlvfakmkgyphwpariddkypifffgthetaflgpkdlfpydkckdkygkpnkrk
gfneglweiqnnpha

Timeline for d3eaeb_:

• d3eaeb_ first appeared in SCOPe 2.01
  
• d3eaeb_ appears in SCOPe 2.06
  
• d3eaeb_ appears in the current release, SCOPe 2.08