SCOPe 2.01: Domain d3e9tc_: 3e9t C:

Lineage for d3e9tc_ (3e9t C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.27: CalX-like [141072] (2 families)

5. Family b.1.27.0: automated matches [191575] (1 protein)
   not a true family

6. Protein automated matches [191010] (2 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [188762] (3 PDB entries)

8. Domain d3e9tc_: 3e9t C: [174781]
   automated match to d2fwsa1
   complexed with ca

Details for d3e9tc_

PDB Entry: 3e9t, 1.6 Å

PDB Description: Crystal structure of Apo-form Calx CBD1 domain

PDB Compounds: (C:) Na/Ca exchange protein

SCOPe Domain Sequences for d3e9tc_:

Sequence, based on SEQRES records:

>d3e9tc_ b.1.27.0 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
efirmyfepghytvmencgefevrvvrrgdistyasveyetqdgtasagtdfvgrkglls
fppgvdeqrfrievidddvfeedecfyirlfnpsegvklavpmiatvmil

Sequence, based on observed residues (ATOM records):

>d3e9tc_ b.1.27.0 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
efirmyfepghytvmencgefevrvvrrgdistyasveyetqdgtasagtdfvgrkglls
fppgvdeqrfrievidedecfyirlfnpsegvklavpmiatvmil

Timeline for d3e9tc_:

• d3e9tc_ is new in SCOPe 2.01-stable
  
• d3e9tc_ appears in SCOPe 2.02
  
• d3e9tc_ appears in the current release, SCOPe 2.08, called d3e9tc1