SCOPe 2.01: Domain d3e85a_: 3e85 A:

Lineage for d3e85a_ (3e85 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)

6. Protein automated matches [190058] (4 species)
   not a true protein

7. Species Yellow lupine (Lupinus luteus) [TaxId:3873] [186854] (2 PDB entries)

8. Domain d3e85a_: 3e85 A: [174736]
   automated match to d1xdfa1
   complexed with bsu, na

Details for d3e85a_

PDB Entry: 3e85, 1.95 Å

PDB Description: crystal structure of pathogenesis-related protein llpr-10.2b from yellow lupine in complex with diphenylurea

PDB Compounds: (A:) pr10.2b

SCOPe Domain Sequences for d3e85a_:

Sequence; same for both SEQRES and ATOM records:

>d3e85a_ d.129.3.1 (A:) automated matches {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gvftfqdeytstiapaklykalvtdadiiipkavetiqsveivegnggpgtikkltfieg
geskyvlhkieaideanlgynysivggvglpdtiekisfetklveganggsigkvtikie
tkgdaqpneeegkaakargdaffkaiesylsahp

Timeline for d3e85a_:

• d3e85a_ is new in SCOPe 2.01-stable
  
• d3e85a_ appears in SCOPe 2.02
  
• d3e85a_ appears in the current release, SCOPe 2.08