Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.133: RbsD-like [102545] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest |
Superfamily c.133.1: RbsD-like [102546] (2 families) |
Family c.133.1.0: automated matches [191558] (1 protein) not a true family |
Protein automated matches [190962] (6 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [188582] (1 PDB entry) |
Domain d3e7na_: 3e7n A: [174719] automated match to d1ogca_ complexed with edo |
PDB Entry: 3e7n (more details), 2.45 Å
SCOPe Domain Sequences for d3e7na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e7na_ c.133.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]} namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa virsgecspyanvilcagvt
Timeline for d3e7na_: